PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04285.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 319aa    MW: 34648.5 Da    PI: 7.565
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04285.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-1785130147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+W+ eEd  l + v++lG ++W++Iar ++ gR++k+c++rw + 
  Zmw_sc04285.1.g00080.1.sm.mk  85 RGPWSSEEDAVLSNMVEKLGARNWTLIARGIP-GRSGKSCRLRWCNQ 130
                                   89******************************.***********985 PP

2Myb_DNA-binding54.13.6e-17137181147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   r+++T+eEd +++ a++ +G++ W++Ia+ +  gRt++ +k++w++ 
  Zmw_sc04285.1.g00080.1.sm.mk 137 RKPFTEEEDRIIIAAHAVHGNK-WAAIAKLLV-GRTDNAIKNHWNST 181
                                   789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.75180131IPR017930Myb domain
SuperFamilySSF466895.75E-3083178IPR009057Homeodomain-like
SMARTSM007177.4E-1484133IPR001005SANT/Myb domain
PfamPF002496.7E-1685130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2586138IPR009057Homeodomain-like
CDDcd001679.24E-1487129No hitNo description
PROSITE profilePS5129427.026132186IPR017930Myb domain
SMARTSM007171.3E-16136184IPR001005SANT/Myb domain
PfamPF002493.8E-15137181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-24139186IPR009057Homeodomain-like
CDDcd001676.91E-13139182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSDETAVPPP PPSDPPTAAD AVATHPYTAD ESQAPTEPQP EPQPQPHYSS PPPSGDDDEV  60
SIISAPSALG DIAPARAAAR EERVRGPWSS EEDAVLSNMV EKLGARNWTL IARGIPGRSG  120
KSCRLRWCNQ LDPQVKRKPF TEEEDRIIIA AHAVHGNKWA AIAKLLVGRT DNAIKNHWNS  180
TLRRRICNGD RCSHGGAVEP AIPEASKEVS EEPWASGDLN SLQNIDSITN QYFSLVEENL  240
RTFSGSRAAT GKAADCDASG DVGTAQRVMQ RQDHKMQAGF HGVKPRQAAG GVPARHRRPT  300
NLADRRAGRF CQFKQATQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-41841866108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458769.11e-92hypothetical protein SORBIDRAFT_03g039950
TrEMBLA0A0A8ZM405e-95A0A0A8ZM40_ARUDO; Uncharacterized protein
STRINGSb03g039950.13e-92(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647